Web Analysis for Pierresfamilycleaningservices - pierresfamilycleaningservices.com
4.68
Rating by CuteStat
pierresfamilycleaningservices.com is 4 years 4 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, pierresfamilycleaningservices.com is SAFE to browse.
PageSpeed Score
87
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 109.201.133.39)
fetishok.com - This website is for sale! - fetishok Resources and Info
- fetishok.com
This website is for sale! fetishok.com is your first and best source for information about fetishok . Here you will also find topics relating to issues of general interest. We hope you find what you are looking for!
6,113,145
$
240.00
HTTP Header Analysis
HTTP/1.1 200 OK
cache-control: max-age=0, private, must-revalidate
connection: close
content-length: 489
content-type: text/html; charset=utf-8
date: Sat, 25 Jan 2020 14:02:11 GMT
server: nginx
cache-control: max-age=0, private, must-revalidate
connection: close
content-length: 489
content-type: text/html; charset=utf-8
date: Sat, 25 Jan 2020 14:02:11 GMT
server: nginx
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.brainydns.com | 74.63.241.18 | United States of America | |
ns2.brainydns.com | 5.79.65.16 | The Netherlands |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
pierresfamilycleaningservices.com | A | 600 |
IP: 109.201.133.39 |
pierresfamilycleaningservices.com | NS | 600 |
Target: ns2.koaladns.com |
pierresfamilycleaningservices.com | NS | 600 |
Target: ns1.koaladns.com |
pierresfamilycleaningservices.com | SOA | 300 |
MNAME: ns1.koaladns.com RNAME: admin.pierresfamilycleaningservices.com Serial: 2020010703 Refresh: 86400 Retry: 10800 Expire: 604800 Minimum TTL: 300 |
Full WHOIS Lookup
Domain Name: PierresFamilyCleaningServices.com
Registry Domain ID: 2475622538_DOMAIN_COM-VRSN
Registrar WHOIS server: whois.NameBright.com
Registrar URL: http://www.NameBright.com
Updated Date: 2020-01-03T00:00:00.000Z
Creation Date: 2020-01-03T07:00:00.000Z
Registrar Registration Expiration Date: 2021-01-03T00:00:00.000Z
Registrar: DropCatch.com 1371 LLC
Registrar IANA ID: 3580
Registrar Abuse Contact Email: abuse@NameBright.com
Registrar Abuse Contact Phone: +1.7204960020
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Jane Dew
Registrant Organization:
Registrant Street: 233 Markey Street
Registrant City: Camana Bay
Registrant State/Province: Grand Cayman
Registrant Postal Code: KY1-9006
Registrant Country: KY
Registrant Phone: +1.2542245346
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 1domains12345@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: Jane Dew
Admin Organization:
Admin Street: 233 Markey Street
Admin City: Camana Bay
Admin State/Province: Grand Cayman
Admin Postal Code: KY1-9006
Admin Country: KY
Admin Phone: +1.2542245346
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: 1domains12345@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: Jane Dew
Tech Organization:
Tech Street: 233 Markey Street
Tech City: Camana Bay
Tech State/Province: Grand Cayman
Tech Postal Code: KY1-9006
Tech Country: KY
Tech Phone: +1.2542245346
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: 1domains12345@gmail.com
Name Server: ns1.brainydns.com
Name Server: ns2.brainydns.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net
>>> Last update of WHOIS database: 2020-01-25T01:25:08.967Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registry Domain ID: 2475622538_DOMAIN_COM-VRSN
Registrar WHOIS server: whois.NameBright.com
Registrar URL: http://www.NameBright.com
Updated Date: 2020-01-03T00:00:00.000Z
Creation Date: 2020-01-03T07:00:00.000Z
Registrar Registration Expiration Date: 2021-01-03T00:00:00.000Z
Registrar: DropCatch.com 1371 LLC
Registrar IANA ID: 3580
Registrar Abuse Contact Email: abuse@NameBright.com
Registrar Abuse Contact Phone: +1.7204960020
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Jane Dew
Registrant Organization:
Registrant Street: 233 Markey Street
Registrant City: Camana Bay
Registrant State/Province: Grand Cayman
Registrant Postal Code: KY1-9006
Registrant Country: KY
Registrant Phone: +1.2542245346
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 1domains12345@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: Jane Dew
Admin Organization:
Admin Street: 233 Markey Street
Admin City: Camana Bay
Admin State/Province: Grand Cayman
Admin Postal Code: KY1-9006
Admin Country: KY
Admin Phone: +1.2542245346
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: 1domains12345@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: Jane Dew
Tech Organization:
Tech Street: 233 Markey Street
Tech City: Camana Bay
Tech State/Province: Grand Cayman
Tech Postal Code: KY1-9006
Tech Country: KY
Tech Phone: +1.2542245346
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: 1domains12345@gmail.com
Name Server: ns1.brainydns.com
Name Server: ns2.brainydns.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net
>>> Last update of WHOIS database: 2020-01-25T01:25:08.967Z <<<
For more information on Whois status codes, please visit https://icann.org/epp