4.68 Rating by CuteStat

pierresfamilycleaningservices.com is 4 years 4 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, pierresfamilycleaningservices.com is SAFE to browse.

PageSpeed Score
87
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

109.201.133.39

Hosted Country:

The Netherlands NL

Location Latitude:

52.0089

Location Longitude:

5.9647

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 109.201.133.39)

Loading...

- celebrityupskirtshots.com
Not Applicable $ 8.95

Loading...

- p-charm.com
Not Applicable $ 8.95

Loading...

- flashjolt.com
6,288,659 $ 240.00

Loading...

- cpacareercoach.com
Not Applicable $ 8.95

fetishok.com - This website is for sale! - fetishok Resources and Info

- fetishok.com

This website is for sale! fetishok.com is your first and best source for information about fetishok . Here you will also find topics relating to issues of general interest. We hope you find what you are looking for!

6,113,145 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
cache-control: max-age=0, private, must-revalidate
connection: close
content-length: 489
content-type: text/html; charset=utf-8
date: Sat, 25 Jan 2020 14:02:11 GMT
server: nginx

Domain Information

Domain Registrar: DropCatch.com 1371 LLC
Registration Date: Jan 3, 2020, 12:45 PM 4 years 4 months 6 days ago
Expiration Date: Jan 3, 2021, 5:45 AM 3 years 4 months 1 week ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns1.brainydns.com 74.63.241.18 United States of America United States of America
ns2.brainydns.com 5.79.65.16 The Netherlands The Netherlands

DNS Record Analysis

Host Type TTL Extra
pierresfamilycleaningservices.com A 600 IP: 109.201.133.39
pierresfamilycleaningservices.com NS 600 Target: ns2.koaladns.com
pierresfamilycleaningservices.com NS 600 Target: ns1.koaladns.com
pierresfamilycleaningservices.com SOA 300 MNAME: ns1.koaladns.com
RNAME: admin.pierresfamilycleaningservices.com
Serial: 2020010703
Refresh: 86400
Retry: 10800
Expire: 604800
Minimum TTL: 300

Full WHOIS Lookup

Domain Name: PierresFamilyCleaningServices.com
Registry Domain ID: 2475622538_DOMAIN_COM-VRSN
Registrar WHOIS server: whois.NameBright.com
Registrar URL: http://www.NameBright.com
Updated Date: 2020-01-03T00:00:00.000Z
Creation Date: 2020-01-03T07:00:00.000Z
Registrar Registration Expiration Date: 2021-01-03T00:00:00.000Z
Registrar: DropCatch.com 1371 LLC
Registrar IANA ID: 3580
Registrar Abuse Contact Email: abuse@NameBright.com
Registrar Abuse Contact Phone: +1.7204960020
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Jane Dew
Registrant Organization:
Registrant Street: 233 Markey Street
Registrant City: Camana Bay
Registrant State/Province: Grand Cayman
Registrant Postal Code: KY1-9006
Registrant Country: KY
Registrant Phone: +1.2542245346
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 1domains12345@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: Jane Dew
Admin Organization:
Admin Street: 233 Markey Street
Admin City: Camana Bay
Admin State/Province: Grand Cayman
Admin Postal Code: KY1-9006
Admin Country: KY
Admin Phone: +1.2542245346
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: 1domains12345@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: Jane Dew
Tech Organization:
Tech Street: 233 Markey Street
Tech City: Camana Bay
Tech State/Province: Grand Cayman
Tech Postal Code: KY1-9006
Tech Country: KY
Tech Phone: +1.2542245346
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: 1domains12345@gmail.com
Name Server: ns1.brainydns.com
Name Server: ns2.brainydns.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net
>>> Last update of WHOIS database: 2020-01-25T01:25:08.967Z <<<

For more information on Whois status codes, please visit https://icann.org/epp